PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00661-snap-gene-0.41-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SRS
Protein Properties Length: 273aa    MW: 29458.4 Da    PI: 6.5648
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00661-snap-gene-0.41-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.82.3e-71502033154
                                     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaea 70 
                                                 g++sCqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpa+krrerqqqlaa++++++++++++
  maker-scaffold00661-snap-gene-0.41-mRNA-1  50 IGGISCQDCGNQAKKDCIHMRCRTCCKSRGFDCHTHVKSTWVPASKRRERQQQLAALQQQQQHQQHQH 117
                                                5789****************************************************999998887444 PP

                                     DUF702  71 askrkrel..kskkqsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtav 136
                                                + + +  +  k ++++ ++st    ++s + le+ ++P+evss+avfrcvrvss+dd ++++aYqtav
  maker-scaffold00661-snap-gene-0.41-mRNA-1 118 QLELRGGEhpKRHRENPSTSTLARLHTSASGLEVGNFPSEVSSPAVFRCVRVSSIDDTDDQYAYQTAV 185
                                                43322222122233333334444556778899************************************ PP

                                     DUF702 137 sigGhvfkGiLydqGlee 154
                                                +igGhvfkGiLydqG+e+
  maker-scaffold00661-snap-gene-0.41-mRNA-1 186 NIGGHVFKGILYDQGPET 203
                                                ****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.8E-6952202IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.5E-275496IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.1E-29154201IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MAGFFSLGGG RGRGRGGSSE EDQETNNNNP PNEIPPESLL HQEEEEEEGI GGISCQDCGN  60
QAKKDCIHMR CRTCCKSRGF DCHTHVKSTW VPASKRRERQ QQLAALQQQQ QHQQHQHQLE  120
LRGGEHPKRH RENPSTSTLA RLHTSASGLE VGNFPSEVSS PAVFRCVRVS SIDDTDDQYA  180
YQTAVNIGGH VFKGILYDQG PETNYSMGGE SSSGGGGVHP LNLIAGATTS PTTTHGGAAA  240
MVSSAMALLD PSLYPAPLNS FMAGTQFFQP PRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012466169.12e-97PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9SD404e-79SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A0D2QC222e-97A0A0D2QC22_G
STRINGPOPTR_0007s13610.11e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.12e-68Lateral root primordium (LRP) protein-related